DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GstD1

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster


Alignment Length:208 Identity:77/208 - (37%)
Similarity:114/208 - (54%) Gaps:7/208 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   815 YAVSDGPPSLAVRMTLKALDIQY--QLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSESI 877
            |.:....|..:|.||.||:.::.  :|:|:.  |.||...|:.|:|||..||.|.|:||.|.||.
  Fly     5 YYLPGSSPCRSVIMTAKAVGVELNKKLLNLQ--AGEHLKPEFLKINPQHTIPTLVDNGFALWESR 67

  Fly   878 AIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKRTPMSLKKVQ 942
            ||..||.:||....:|||:....||||||||.|:||..|...:.:....:|......|.:.||::
  Fly    68 AIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKIE 132

  Fly   943 NALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQFTLVNKWYETFKVEYPQLW 1007
            .|.:...|:|:  |..||||:::|:||.||::.....|...|::.::..||:|||..|...|. |
  Fly   133 AAFEFLNTFLE--GQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAKKVTPG-W 194

  Fly  1008 EIANSGMQEISAF 1020
            |...:|..|...:
  Fly   195 EENWAGCLEFKKY 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 30/72 (42%)
GstA 812..1000 CDD:223698 71/186 (38%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 41/116 (35%)
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 30/71 (42%)
GstA 4..185 CDD:223698 69/183 (38%)
GST_C_Delta_Epsilon 89..205 CDD:198287 42/118 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.920

Return to query results.
Submit another query.