DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GstZ2

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster


Alignment Length:201 Identity:51/201 - (25%)
Similarity:83/201 - (41%) Gaps:24/201 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   802 SYGSIVPIYTMKLYAVSDGPPSLAVRMTLKALDIQYQL--INVDFCAMEHRSEEYSKMNPQKEIP 864
            |...|.||    ||:......|..||:.:...:|.|.:  |::.....|....||.::||.:::|
  Fly    10 SSSDIQPI----LYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVP 70

  Fly   865 VLDDDGFYLSESIAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPI-- 927
            .|..||..|.||:|||.|| ::..|...|.||||:.||.:.:         ...|....:.|:  
  Fly    71 ALQIDGHTLIESVAIMHYL-EETRPQRPLLPQDVHKRAKVRE---------IVEIICSGIQPLQN 125

  Fly   928 ------FFDYKRTPMSLKKVQNALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDL 986
                  ..:.|:...:...:.......|..|.....||..|:.|::||..|:.........:.||
  Fly   126 LIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDL 190

  Fly   987 HQFTLV 992
            ..:.::
  Fly   191 RPYPII 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 25/76 (33%)
GstA 812..1000 CDD:223698 47/191 (25%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 16/101 (16%)
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 27/78 (35%)
maiA 17..221 CDD:273527 48/194 (25%)
GST_C_Zeta 104..217 CDD:198300 16/102 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.