DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and gstt1b

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:174 Identity:46/174 - (26%)
Similarity:79/174 - (45%) Gaps:15/174 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   811 TMKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSE 875
            |:::|......|..:|.:..|..:||:....:.........||:.|:||.::.|.:.|..|.|:|
Zfish     2 TLEIYLDLFSQPCRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAE 66

  Fly   876 SIAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFF-----DYKRTP 935
            |:|||.||.||:......:|.|:..||.:|:.|    .:.:..|..|....|:|     :.....
Zfish    67 SVAIMIYLADKFHTPDHWFPADLQKRARVNEYL----SWQHTSIRMHGAKIIWFKILIPEVLGAE 127

  Fly   936 MSLKKVQNALDVFETYLQRLGTK------YAAGENITIADFALI 973
            :..:|::||.:.....||....|      :..|:.|::||...|
Zfish   128 VPKEKMENAEENLNVALQLFQDKFLQDKPFIVGDQISLADLVAI 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 23/74 (31%)
GstA 812..1000 CDD:223698 45/173 (26%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 19/85 (22%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 46/174 (26%)
GST_N_Theta 3..78 CDD:239348 23/74 (31%)
GST_C_Theta 91..217 CDD:198292 19/85 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.