DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GstO1

DIOPT Version :10

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:224 Identity:55/224 - (24%)
Similarity:97/224 - (43%) Gaps:53/224 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   804 GSIVPIY----TMKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIP 864
            ||..|::    .:|||::...|.:..|.:.|.|..|.|..|.::   :..:.|.:|.::...::|
  Fly    10 GSPKPVFPDDGILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYIN---LRDKPEWFSLVSSSTKVP 71

  Fly   865 VLD---DDGF-YLSESIAIMQYLCDKYAPDSTLYPQDVNVRA---VINQRL-CFNMGFYYAPISA 921
            .|:   :.|. .|.||:.|..||.:|| |:..|||:|:..:|   ::.:|. .|...|||  :..
  Fly    72 ALELVKEQGNPVLIESLIICDYLDEKY-PEVPLYPKDLLKKAQEKILIERFGQFINAFYY--LLL 133

  Fly   922 HSMAPIFFDYKRTPMSLKKVQN--ALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINF 984
            |.          .|..|....:  .|.|:|..|:|..||:..|::..:.|:              
  Fly   134 HD----------NPEQLVDTDHYAGLVVYEEELKRRCTKFFGGDSPGMLDY-------------- 174

  Fly   985 DLHQFTLVNKWYETF---KVEYPQLWEIA 1010
                  ::..|.|.|   |..:.|.:|::
  Fly   175 ------MMWPWCERFDSLKYTFEQKFELS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:461332
FLYWCH 162..229 CDD:461332
FLYWCH 365..432 CDD:461332
FLYWCH 597..663 CDD:461332
GstA 812..1000 CDD:440390 49/200 (25%)
GstO1NP_648237.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 23/87 (26%)
GST_C_Omega 109..234 CDD:198293 24/121 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.