DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GstO2

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster


Alignment Length:216 Identity:55/216 - (25%)
Similarity:98/216 - (45%) Gaps:44/216 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   813 KLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGF----YL 873
            :.::::..|.|..||:.|.|..|::..|.||   :..:.|.|...:|..::|.|...|.    .|
  Fly    24 RFFSMAFCPFSHRVRLMLAAKHIEHHKIYVD---LIEKPEWYKDFSPLGKVPALQLTGVKDQPTL 85

  Fly   874 SESIAIMQYLCDKYAPDSTLYPQDVNVRA---VINQRLCFNMGFYYAPISAHSMAPIFFDYKRTP 935
            .||:.|.:||..:| |.:.|:|.|...:|   ::.:|        :||: ..::.|:.......|
  Fly    86 VESLIIAEYLDQQY-PQTRLFPTDPLQKALDKILIER--------FAPV-VSAIYPVLTCNPNAP 140

  Fly   936 M-SLKKVQNALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQFTLVNKWYETF 999
            . ::...:|||||||..|.:.||.|.||::|.|.|:                    ::..|:|.|
  Fly   141 KDAIPNFENALDVFEVELGKRGTPYFAGQHIGIVDY--------------------MIWPWFERF 185

  Fly  1000 ---KVEYPQLWEIANSGMQEI 1017
               |:...|.:|:.....:::
  Fly   186 PSMKINTEQKYELDTKRFEKL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 22/76 (29%)
GstA 812..1000 CDD:223698 52/197 (26%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 28/123 (23%)
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 21/74 (28%)
GstA 25..215 CDD:223698 55/215 (26%)
GST_C_Omega 110..235 CDD:198293 28/126 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5020
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.