DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GstE11

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:195 Identity:69/195 - (35%)
Similarity:98/195 - (50%) Gaps:10/195 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   805 SIVPIYTMKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDD 869
            |..||    ||.....||..||.:|..||.::..|..|:..|.||:|.|:.|:|.|..||||||:
  Fly     2 SAKPI----LYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDN 62

  Fly   870 GFYLSESIAIMQYLCDKYAP--DSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYK 932
            |..:|:|..|..||.|||||  |.:|||:|...|.:::.||.::.|..:..|.......|:|...
  Fly    63 GTIVSDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAG 127

  Fly   933 RTPMS-LKKVQNALDVFETYLQRLGTKYAAGENITIADFALISATICLEAI-NFDLHQFTLVNKW 995
            ..|.. :..:|.|.|..|..|..  ..|..|:.:||||.:.|::....||. ..:..||..:.:|
  Fly   128 EVPSDRVAYLQKAYDGLEHCLAE--GDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQW 190

  Fly   996  995
              Fly   191  190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 31/74 (42%)
GstA 812..1000 CDD:223698 66/188 (35%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 25/98 (26%)
GstE11NP_001286575.1 GstA 5..198 CDD:223698 68/192 (35%)
GST_N_Delta_Epsilon 5..78 CDD:239343 33/76 (43%)
GST_C_Delta_Epsilon 94..211 CDD:198287 25/99 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I3172
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
87.920

Return to query results.
Submit another query.