DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GstE7

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster


Alignment Length:210 Identity:72/210 - (34%)
Similarity:119/210 - (56%) Gaps:6/210 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   814 LYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSESIA 878
            ||.:...||..||::||.||::.|:.:.|:..|.|:.|||:.|.|||..:|.|:|||.|:.:|.|
  Fly     6 LYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDSHA 70

  Fly   879 IMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKRTPMSLKKVQN 943
            |:.||..||....:|||:|:..|||::|||.|..|..:|........|:|.. |:|.:..::...
  Fly    71 IIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAG-KQTMIPKERYDA 134

  Fly   944 ALDVFETYLQRL--GTKYAAGENITIADFALISATICLEA-INFDLHQFTLVNKWYETFKVEYPQ 1005
            .::|:: :|::.  |..|.||..:|||||::||....||. :..|..::..:..|::..: :.|.
  Fly   135 IIEVYD-FLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIAAWFKRLQ-KLPY 197

  Fly  1006 LWEIANSGMQEISAF 1020
            ..|...:|.:...:|
  Fly   198 YEEANGNGARTFESF 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 32/71 (45%)
GstA 812..1000 CDD:223698 68/188 (36%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 33/119 (28%)
GstE7NP_611329.1 GstA 4..196 CDD:223698 68/192 (35%)
GST_N_Delta_Epsilon 4..77 CDD:239343 32/70 (46%)
GST_C_Delta_Epsilon 91..209 CDD:198287 33/120 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I643
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
87.920

Return to query results.
Submit another query.