DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GstE3

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster


Alignment Length:217 Identity:72/217 - (33%)
Similarity:117/217 - (53%) Gaps:17/217 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 MKLYAVSDGPPSLAVRMTLKA--LDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLS 874
            :.||.:...||..:|.:||:|  ||..|:::|:  ...||...|:.|:||...:|.|||:||||:
  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNL--MEKEHLKPEFLKINPLHTVPALDDNGFYLA 66

  Fly   875 ESIAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYK-RTPM-- 936
            :|.||..||..||..:.:|||:|:..||:::|||.::.....:...|.:. |:|::.| ..|.  
  Fly    67 DSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITF-PLFWENKTEIPQAR 130

  Fly   937 --SLKKVQNALDVFETYLQRLGTKYAAGENITIADFALISA-TICLEAINFDLHQFTLVNKWYET 998
              :|:.|..:|::|   |:  ...|.||:|:|||||.:|:. |.....:..|..::..:..|.:.
  Fly   131 IDALEGVYKSLNLF---LE--NGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKR 190

  Fly   999 FKVEYPQLWEIANSGMQEISAF 1020
            .| |.|...|...|...:|..|
  Fly   191 IK-ELPYYEEANGSRAAQIIEF 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 31/75 (41%)
GstA 812..1000 CDD:223698 65/195 (33%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 33/122 (27%)
GstE3NP_611325.2 GstA 4..195 CDD:223698 67/199 (34%)
GST_N_Delta_Epsilon 4..77 CDD:239343 31/74 (42%)
GST_C_Delta_Epsilon 91..208 CDD:198287 33/123 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I643
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
87.920

Return to query results.
Submit another query.