DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GstT1

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster


Alignment Length:215 Identity:54/215 - (25%)
Similarity:96/215 - (44%) Gaps:27/215 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   822 PSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSESIAIMQYLCDK 886
            ||.|:.:.:|.....::...|.....|..::||..:|..:::|.:.|..|.|.||::|::||.||
  Fly    15 PSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGESVSIVRYLADK 79

  Fly   887 YAPDSTLYPQDVNVRAVI---------NQRLCFNMGF---YYAPISAHSMAPIFFDYKRTPMSLK 939
            ......|||:.:..||.:         |.||..::.|   :..|....:.||       .|.|:|
  Fly    80 GVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAPAP-------KPESVK 137

  Fly   940 KVQNALDVFETYLQRLGTK--YAAGENITIADF----ALISATICLEAINFDLHQFTLVNKWYET 998
            |:...::.....|:||..:  :..|:.:|:||.    .:....:|  ..|.:..||..|.||.|.
  Fly   138 KLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLC--QYNVNEKQFPKVAKWMER 200

  Fly   999 FKVEYPQLWEIANSGMQEIS 1018
            .:......::.|:|.:.:.|
  Fly   201 VRDATNPYYDEAHSFVYKTS 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 18/63 (29%)
GstA 812..1000 CDD:223698 51/195 (26%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 30/134 (22%)
GstT1NP_610509.2 GstA 5..204 CDD:223698 51/197 (26%)
GST_N_Theta 5..80 CDD:239348 19/64 (30%)
GST_C_Theta 93..218 CDD:198292 30/133 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
54.820

Return to query results.
Submit another query.