DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GstE13

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster


Alignment Length:207 Identity:61/207 - (29%)
Similarity:101/207 - (48%) Gaps:5/207 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   814 LYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPV-LDDDGFYLSESI 877
            ||.....||:.|..:..|.:.:..:|..|||...||.|||:.|:|||.:||| :|.||....:|.
  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70

  Fly   878 AIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIF-FDYKRTPMSLKKV 941
            ||:.:|..|||.:..|||:|:..||.|:.|:.:..|..:..:.......|: .:.:..|.||...
  Fly    71 AIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEGEYNPRSLTLC 135

  Fly   942 QNALDVFETYLQRLGTKYAAGENITIADFALISATICLE-AINFDLHQFTLVNKWYETFKVEYPQ 1005
            .||....|.:||:  ..:..|..:::||.::.:..:.|: .|..:..::....:|.|......|.
  Fly   136 HNAYSDLEHFLQQ--GSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDKLLPD 198

  Fly  1006 LWEIANSGMQEI 1017
            ..||...|.:.:
  Fly   199 NEEINLKGARAL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 29/72 (40%)
GstA 812..1000 CDD:223698 57/188 (30%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 25/118 (21%)
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 29/71 (41%)
GST_C_Delta_Epsilon 92..211 CDD:198287 25/121 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I3172
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
87.920

Return to query results.
Submit another query.