DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GstT3

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster


Alignment Length:211 Identity:48/211 - (22%)
Similarity:99/211 - (46%) Gaps:30/211 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   831 KALDIQYQLINVDF--CAM-----EHRSEEYSK-MNPQKEIPVLDDDGFYLSESIAIMQYLCDKY 887
            :||.|.::|.|:.|  |.:     ||.:|::.| :|..:.:|.:.|:|:.|:||:||::||..|.
  Fly    57 RALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLSAKG 121

  Fly   888 APDSTLYPQDVNVRAVINQ-------RLCFNMGFYYAPISAHSMAPIFFDYKRTPMSLK------ 939
            .....|||:....::.:::       .|......|:..:   .:.|:...  |||...|      
  Fly   122 KIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTV---WLEPLLTG--RTPSEAKIETFRM 181

  Fly   940 KVQNALDVF-ETYLQRLGTKYAAGENITIADFALISATICLEAINFDLH-QFTLVNKWYETFKVE 1002
            :::..|||. |.:|:  |..:..|.::|:||.............::|:. ::..:..|.:..:..
  Fly   182 QMERNLDVVEEVWLE--GKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIRAWLKRVRQS 244

  Fly  1003 YPQLWEIANSGMQEIS 1018
            ....:::|:..:.:||
  Fly   245 CNPYYDVAHEFVYKIS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 22/62 (35%)
GstA 812..1000 CDD:223698 45/191 (24%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 20/131 (15%)
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 22/63 (35%)
GstA 47..243 CDD:223698 45/192 (23%)
GST_C_Theta 135..259 CDD:198292 20/130 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
54.820

Return to query results.
Submit another query.