DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GstT4

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster


Alignment Length:232 Identity:58/232 - (25%)
Similarity:108/232 - (46%) Gaps:34/232 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 MKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEY-SKMNPQKEIPVLDDDGFYLSE 875
            :|.|.......|.|:.:.|:|..|.::.|.:.....||.:.|: ..:|..:::|.:.|.|:.|||
  Fly     5 LKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSE 69

  Fly   876 SIAIMQYLC-DKYAPDSTLYPQDVNVRAVINQRLCF---NMGF----YYAPISAHSMAPIFFDYK 932
            ::||.::|. :|..|:. .||:....|:.|::.|.:   |||.    |:   ....:.|  :..|
  Fly    70 NVAIFRHLAREKLVPEH-WYPRRHLGRSRIDEYLAWQQTNMGVATTEYF---QQKWLVP--YLQK 128

  Fly   933 RTP------MSLKKVQNALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQ-FT 990
            ..|      ::.|::::.|:.||..... ..|:..|:||:.||.:.|......::|.::..| ..
  Fly   129 TRPADNAVNLASKQLEHTLNEFEQLFLN-SRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNRN 192

  Fly   991 LVNKWYETFKVEY-PQLWEI----------ANSGMQE 1016
            .:.:||||.:.|. |...|:          :.||.|:
  Fly   193 KLARWYETVREELGPHYKEVLGEFEAKLKGSGSGQQQ 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 21/75 (28%)
GstA 812..1000 CDD:223698 52/203 (26%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 33/142 (23%)
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 21/74 (28%)
GST_C_Theta 95..220 CDD:198292 30/130 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
54.820

Return to query results.
Submit another query.