| Sequence 1: | NP_001014610.1 | Gene: | gfzf / 40858 | FlyBaseID: | FBgn0250732 | Length: | 1045 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001350632.1 | Gene: | GSTZ1 / 2954 | HGNCID: | 4643 | Length: | 217 | Species: | Homo sapiens |
| Alignment Length: | 207 | Identity: | 53/207 - (25%) |
|---|---|---|---|
| Similarity: | 89/207 - (42%) | Gaps: | 26/207 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 814 LYAVSDGPPSLAVRMTLKALDIQYQLINVDFC--AMEHRSEEYSKMNPQKEIPVLDDDGFYLSES 876
Fly 877 IAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPI----FFDYKRTPMS 937
Fly 938 LKKVQNAL----DVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQF---TLVNK- 994
Fly 995 --WYETFKVEYP 1004 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gfzf | NP_001014610.1 | FLYWCH | 18..87 | CDD:282369 | |
| FLYWCH | 162..229 | CDD:282369 | |||
| FLYWCH | 365..432 | CDD:282369 | |||
| FLYWCH | 597..663 | CDD:282369 | |||
| Thioredoxin_like | 811..886 | CDD:294274 | 21/73 (29%) | ||
| GstA | 812..1000 | CDD:223698 | 50/201 (25%) | ||
| GST_C_Delta_Epsilon | 900..1017 | CDD:198287 | 27/119 (23%) | ||
| GSTZ1 | NP_001350632.1 | maiA | 8..212 | CDD:273527 | 53/207 (26%) |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||