DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and Eef1g

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_001004223.1 Gene:Eef1g / 293725 RGDID:1302939 Length:437 Species:Rattus norvegicus


Alignment Length:164 Identity:39/164 - (23%)
Similarity:77/164 - (46%) Gaps:15/164 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   849 HRSEEYSKMNPQKEIPVLD-DDGFYLSESIAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNM 912
            :|:.|:.:..|..::|..: ||||.:.||.||..|:.::....||  |:   ..|.:.|.:.|..
  Rat    44 NRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGST--PE---AAAQVVQWVSFAD 103

  Fly   913 GFYYAPISA---HSMAPIFFDYKRTPMSLKKVQNALDVFETYLQRLGTKYAAGENITIADFALIS 974
            .....|.|.   .::..:..:.:.|..:.::|:..|.:.:|:|:.  ..:..||.:|:||..::.
  Rat   104 SDIVPPASTWVFPTLGIMHHNKQATENAKEEVKRILGLLDTHLKT--RTFLVGERVTLADITVVC 166

  Fly   975 ATICL--EAINFDLHQ-FTLVNKWYETFKVEYPQ 1005
            ..:.|  :.:.....| |...|:|:.|. :..||
  Rat   167 TLLWLYKQVLEPSFRQAFPNTNRWFLTC-INQPQ 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 13/37 (35%)
GstA 812..1000 CDD:223698 37/157 (24%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 23/112 (21%)
Eef1gNP_001004223.1 GST_N_EF1Bgamma 4..82 CDD:239342 13/37 (35%)
maiA 5..187 CDD:273527 34/149 (23%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 23/112 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268
EF1G 275..381 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.