DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and gst1

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:205 Identity:57/205 - (27%)
Similarity:91/205 - (44%) Gaps:17/205 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   814 LYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDD---DGFYLSE 875
            |::.:.||....|...||.||:.|:...|:|...|.:|.|:..:||...:|.|.|   :.:.:.|
pombe     6 LWSHAHGPNPWKVVQALKELDLTYETRYVNFSKNEQKSPEHLALNPNGRVPTLIDHHNNDYTIWE 70

  Fly   876 SIAIMQYLCDKYAPDSTL-YPQDVNVRAVINQRLCF---NMGFYYAP---ISAHSMAPIFFDYKR 933
            |.||:.||.|||..:..: .|:|......:.|.|.|   ..|..:..   .|.:....:.....|
pombe    71 SDAILIYLADKYDTERKISLPRDHPEYYKVIQYLFFQASGQGIIWGQAGWFSVYHQELVISAITR 135

  Fly   934 TPMSLKKVQNALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQFTLVNKWYE- 997
            ....:|:|   |.|.|..|:  ...|......||||.:.||....||.| |...:|::..:..: 
pombe   136 YRNEIKRV---LGVLEDILK--DRDYLVANRFTIADLSFISWNNFLEII-FAEGKFSIEEEVPQL 194

  Fly   998 TFKVEYPQLW 1007
            .|:.|:|:.:
pombe   195 DFEKEFPRTY 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 25/74 (34%)
GstA 812..1000 CDD:223698 54/196 (28%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 27/115 (23%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 28/77 (36%)
GstA 5..218 CDD:223698 57/205 (28%)
GST_C_Ure2p 96..219 CDD:198326 27/115 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.