DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and AIMP3

DIOPT Version :10

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster


Alignment Length:41 Identity:11/41 - (26%)
Similarity:23/41 - (56%) Gaps:2/41 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   959 YAAGENITIADFALISATICL-EAIN-FDLHQFTLVNKWYE 997
            |..|..||:||.|:..|...| :::: .|...:..:::|::
  Fly   108 YLVGHFITLADLAVYYAIYDLVKSLSPVDKEVYLNLSRWFD 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:461332
FLYWCH 162..229 CDD:461332
FLYWCH 365..432 CDD:461332
FLYWCH 597..663 CDD:461332
GstA 812..1000 CDD:440390 11/41 (27%)
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 11/41 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.