DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and Gstp3

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:XP_030106733.1 Gene:Gstp3 / 225884 MGIID:2385078 Length:260 Species:Mus musculus


Alignment Length:185 Identity:40/185 - (21%)
Similarity:70/185 - (37%) Gaps:46/185 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   862 EIPVLDDDGFYLSESIAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAP 926
            :||...|....|.:|..|:::|...:.    ||.:|....|:::.   .|.|          :..
Mouse   102 QIPKFQDGELTLYQSNTILRHLGRSFG----LYGKDQQEAALVDM---VNDG----------LED 149

  Fly   927 IFFDYKRTPMSL---------KKVQNALDVFETYL--QRLGTKYAAGENITIADFALISATICLE 980
            :|....|....:         |::...|..|||.|  .|.|..:..|:.|:.||:.|:...:.||
Mouse   150 LFRRIARQYRHILKEGKDQYQKELPGHLKPFETLLAQNRGGQSFIVGDQISFADYRLLDVLLNLE 214

  Fly   981 AINFD--LHQFTLVNKWYETFKVEYPQLWEIANSGMQEISAFEQNPPDMSHMEHP 1033
            .: |.  |:.|.|.:.:....|            ...::.||.::|   .|:..|
Mouse   215 LL-FPGYLNDFPLFSAYVARLK------------SRPKLKAFLESP---EHVNRP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 7/23 (30%)
GstA 812..1000 CDD:223698 34/150 (23%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 25/129 (19%)
Gstp3XP_030106733.1 Thioredoxin_like 63..126 CDD:381987 7/23 (30%)
GST_C_family 134..253 CDD:383119 29/147 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.