| Sequence 1: | NP_001014610.1 | Gene: | gfzf / 40858 | FlyBaseID: | FBgn0250732 | Length: | 1045 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001165053.1 | Gene: | Mars1 / 216443 | MGIID: | 1345633 | Length: | 910 | Species: | Mus musculus |
| Alignment Length: | 204 | Identity: | 43/204 - (21%) |
|---|---|---|---|
| Similarity: | 80/204 - (39%) | Gaps: | 34/204 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 812 MKLYAVSDGPP------SLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLD-DD 869
Fly 870 GFYLSESIAIMQY---LCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDY 931
Fly 932 KRTPMSLKKVQNALDVFETYLQRLGTKYAAGENITIADFALISATI-CLEAINFDLHQFTLVNKW 995
Fly 996 YETFKVEYP 1004 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gfzf | NP_001014610.1 | FLYWCH | 18..87 | CDD:282369 | |
| FLYWCH | 162..229 | CDD:282369 | |||
| FLYWCH | 365..432 | CDD:282369 | |||
| FLYWCH | 597..663 | CDD:282369 | |||
| Thioredoxin_like | 811..886 | CDD:294274 | 22/83 (27%) | ||
| GstA | 812..1000 | CDD:223698 | 42/198 (21%) | ||
| GST_C_Delta_Epsilon | 900..1017 | CDD:198287 | 19/106 (18%) | ||
| Mars1 | NP_001165053.1 | Thioredoxin_like | 1..68 | CDD:294274 | 19/76 (25%) |
| GstA | <47..189 | CDD:223698 | 33/148 (22%) | ||
| GST_C_MetRS_N | 77..179 | CDD:198340 | 20/114 (18%) | ||
| PRK12268 | 266..821 | CDD:237029 | |||
| MetRS_core | 267..635 | CDD:173907 | |||
| 'HIGH' region | 275..285 | ||||
| 'KMSKS' region | 595..599 | ||||
| Anticodon_Ia_Met | 644..773 | CDD:153411 | |||
| MetRS_RNA | 855..899 | CDD:238475 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||