DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and gst-21

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_001256002.1 Gene:gst-21 / 191412 WormBaseID:WBGene00001769 Length:231 Species:Caenorhabditis elegans


Alignment Length:224 Identity:47/224 - (20%)
Similarity:87/224 - (38%) Gaps:38/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   807 VPIYTMKLYAVS--DGPPSLA--VRMT--LKALDIQYQLINVDF---CAMEHRSEEYSKMNPQKE 862
            ||:..|..|.::  || ..||  .||.  |..:..:...|.||.   ..|.....:..|..|..:
 Worm     8 VPLQIMPTYKLTYFDG-RGLAEPARMLFHLGGVPFEDSRIPVDMKTGLIMNPELADVKKKAPFGK 71

  Fly   863 IPVLDDDGFYLSESIAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGF---YYAPISAHSM 924
            .|||..|...:::|.||.:||..::........::....:.|:|...:|..|   .||.:..   
 Worm    72 YPVLKIDDIEIAQSAAINRYLARQFGFAGKNPIEEAQADSYIDQCQEYNTSFRACMYATLQG--- 133

  Fly   925 APIFFDYKRTPMSLKKVQNAL---------DVFETYLQRLGTKYAAGENITIADFALISATICLE 980
                    :....::|::..:         ::|...|.|..:.:..|:::|.||..:......|:
 Worm   134 --------KPEEEVQKIREEVYIPAQNKFYEIFSDILNRNKSGFLVGDSLTWADLVIADHLYSLD 190

  Fly   981 AINFDLHQFTLVNKW-YETFKVEYPQLWE 1008
            .:....|:    :.| .||.|....:::|
 Worm   191 TMGMLTHE----DAWRCETLKKFQEKIYE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 24/83 (29%)
GstA 812..1000 CDD:223698 43/209 (21%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 21/122 (17%)
gst-21NP_001256002.1 GST_N_Sigma_like 16..94 CDD:239337 23/78 (29%)
PTZ00057 18..231 CDD:173353 43/214 (20%)
GST_C_Sigma_like 104..213 CDD:198301 20/123 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.