Sequence 1: | NP_001014610.1 | Gene: | gfzf / 40858 | FlyBaseID: | FBgn0250732 | Length: | 1045 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491070.1 | Gene: | gst-43 / 190586 | WormBaseID: | WBGene00001791 | Length: | 214 | Species: | Caenorhabditis elegans |
Alignment Length: | 205 | Identity: | 49/205 - (23%) |
---|---|---|---|
Similarity: | 88/205 - (42%) | Gaps: | 46/205 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 826 VRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSESIAIMQYLCDKYAPD 890
Fly 891 STLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKRTPMSLKKVQNALD--------- 946
Fly 947 -----------VFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQFTLVNKWYE--- 997
Fly 998 ---TFKVEYP 1004 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gfzf | NP_001014610.1 | FLYWCH | 18..87 | CDD:282369 | |
FLYWCH | 162..229 | CDD:282369 | |||
FLYWCH | 365..432 | CDD:282369 | |||
FLYWCH | 597..663 | CDD:282369 | |||
Thioredoxin_like | 811..886 | CDD:294274 | 21/59 (36%) | ||
GstA | 812..1000 | CDD:223698 | 46/199 (23%) | ||
GST_C_Delta_Epsilon | 900..1017 | CDD:198287 | 24/131 (18%) | ||
gst-43 | NP_491070.1 | GST_N_Zeta | 4..77 | CDD:239340 | 20/57 (35%) |
maiA | 5..211 | CDD:273527 | 49/205 (24%) | ||
GST_C_Zeta | 90..207 | CDD:198300 | 24/133 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |