powered by:
Protein Alignment gfzf and gst-36
DIOPT Version :9
Sequence 1: | NP_001014610.1 |
Gene: | gfzf / 40858 |
FlyBaseID: | FBgn0250732 |
Length: | 1045 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509652.2 |
Gene: | gst-36 / 187645 |
WormBaseID: | WBGene00001784 |
Length: | 210 |
Species: | Caenorhabditis elegans |
Alignment Length: | 61 |
Identity: | 17/61 - (27%) |
Similarity: | 32/61 - (52%) |
Gaps: | 3/61 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 826 VRMTLKALDIQYQLINVDFCAMEHRSEEYSKMN---PQKEIPVLDDDGFYLSESIAIMQYL 883
||...:|:.:.:.|.:..|.......|::..:. |..::|||:.||..:|::.||.:||
Worm 11 VRGRGEAIRLLFHLADEKFDDERFGMEQWGVLKSEMPLGQVPVLEIDGVKISQTTAIARYL 71
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.