DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and gst-15

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_496860.1 Gene:gst-15 / 185410 WormBaseID:WBGene00001763 Length:213 Species:Caenorhabditis elegans


Alignment Length:150 Identity:36/150 - (24%)
Similarity:64/150 - (42%) Gaps:7/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   837 YQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSESIAIMQYLCDKYAPDSTLYPQDVNVR 901
            |..|.:.....|.:.|:.....|..::|||:.|||.:.:|.||.:||..|:........::....
 Worm    29 YDDIRIPMADTEGKWEKMRDKTPFGQLPVLNVDGFDIPQSAAICRYLAKKFGYAGKTPEEEAWAD 93

  Fly   902 AVINQRLCFNMGFYYAPISAHSMAPIFFDYKRTPMSLKKVQNALDVFETYLQRLGTK----YAAG 962
            ||::|...|::.|.....:..:..|   :.:...:..:....|.||:...|.|:..|    |..|
 Worm    94 AVVDQFKDFSVAFKTLLFATRAGKP---EEEILKIRYEIFNPARDVYFILLNRILKKSKSGYLVG 155

  Fly   963 ENITIADFALISATICLEAI 982
            :.:|.||..:......||.:
 Worm   156 DGLTWADLVIADNLHSLEKL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 16/48 (33%)
GstA 812..1000 CDD:223698 36/149 (24%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 19/86 (22%)
gst-15NP_496860.1 GST_N_Sigma_like 4..77 CDD:239337 16/47 (34%)
PTZ00057 6..211 CDD:173353 36/149 (24%)
GST_C_Sigma_like 87..195 CDD:198301 19/91 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.