DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and gst-42

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_509962.1 Gene:gst-42 / 183911 WormBaseID:WBGene00001790 Length:214 Species:Caenorhabditis elegans


Alignment Length:229 Identity:59/229 - (25%)
Similarity:98/229 - (42%) Gaps:43/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   814 LYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSESIA 878
            ||:......|..||:.|...::.|:...||..:.|.:| :..::||..::|....||..::||:|
 Worm     8 LYSYWRSSCSWRVRIALALKNVDYEYKTVDLLSEEAKS-KLKEINPAAKVPTFVVDGQVITESLA 71

  Fly   879 IMQYLCDKYAPDSTLYPQD----VNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKRTPMSLK 939
            |::|| ::..||..|.|:|    .:.||:             :.:.|..:.|: .:.|...:..|
 Worm    72 IIEYL-EETHPDVPLLPKDPIKRAHARAI-------------SLLVASGIQPL-HNLKVLQLLNK 121

  Fly   940 K------------VQNALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQFTLV 992
            |            |...|...|..|::...|||.|:::||||.::..........|.||..:..|
 Worm   122 KEAGFGGQFAKQFVVEGLTALEILLKQHSGKYAVGDDVTIADLSIPPLIYSANRFNLDLSPYPTV 186

  Fly   993 NKWYETFKVEYPQLWEIANSGMQEISAFEQNPPD 1026
            |:..||. .:.|..          |:|...|.||
 Worm   187 NRINETL-ADIPAF----------IAAHPDNQPD 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 22/71 (31%)
GstA 812..1000 CDD:223698 53/201 (26%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 27/128 (21%)
gst-42NP_509962.1 GST_N_Zeta 6..77 CDD:239340 22/70 (31%)
maiA 7..211 CDD:273527 59/229 (26%)
GST_C_Zeta 90..207 CDD:198300 29/141 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.