Sequence 1: | NP_001014610.1 | Gene: | gfzf / 40858 | FlyBaseID: | FBgn0250732 | Length: | 1045 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497116.1 | Gene: | gst-27 / 175166 | WormBaseID: | WBGene00001775 | Length: | 209 | Species: | Caenorhabditis elegans |
Alignment Length: | 238 | Identity: | 47/238 - (19%) |
---|---|---|---|
Similarity: | 80/238 - (33%) | Gaps: | 83/238 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 807 VPIYTMKLYAVSD-GPPSLAVRMTLKALDIQYQLINVDF--CAMEHRSEEYSKMNPQKEIPVLDD 868
Fly 869 DGFYLSESIAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKR 933
Fly 934 TPMSLKKVQN---------------------ALDVFETYLQRLGTK----YAAGENITIADFALI 973
Fly 974 SATICLEAINFDLHQ-FT------------------LVNKWYE 997 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gfzf | NP_001014610.1 | FLYWCH | 18..87 | CDD:282369 | |
FLYWCH | 162..229 | CDD:282369 | |||
FLYWCH | 365..432 | CDD:282369 | |||
FLYWCH | 597..663 | CDD:282369 | |||
Thioredoxin_like | 811..886 | CDD:294274 | 20/77 (26%) | ||
GstA | 812..1000 | CDD:223698 | 45/233 (19%) | ||
GST_C_Delta_Epsilon | 900..1017 | CDD:198287 | 25/142 (18%) | ||
gst-27 | NP_497116.1 | GST_N_Sigma_like | 4..75 | CDD:239337 | 21/77 (27%) |
PTZ00057 | 6..208 | CDD:173353 | 45/233 (19%) | ||
GST_C_Sigma_like | 85..191 | CDD:198301 | 22/134 (16%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1231780at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |