| Sequence 1: | NP_001014610.1 | Gene: | gfzf / 40858 | FlyBaseID: | FBgn0250732 | Length: | 1045 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011241675.1 | Gene: | Gstt2 / 14872 | MGIID: | 106188 | Length: | 251 | Species: | Mus musculus |
| Alignment Length: | 209 | Identity: | 55/209 - (26%) |
|---|---|---|---|
| Similarity: | 92/209 - (44%) | Gaps: | 25/209 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 812 MKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSE- 875
Fly 876 ------SIAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFN----MGFYYAPISAHSMAPIFFD 930
Fly 931 YKRTPMSLKKVQNALDVFETYLQRLGTK------YAAGENITIADFALISATICLEAINFDLH-- 987
Fly 988 --QFTLVNKWYETF 999 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gfzf | NP_001014610.1 | FLYWCH | 18..87 | CDD:282369 | |
| FLYWCH | 162..229 | CDD:282369 | |||
| FLYWCH | 365..432 | CDD:282369 | |||
| FLYWCH | 597..663 | CDD:282369 | |||
| Thioredoxin_like | 811..886 | CDD:294274 | 28/80 (35%) | ||
| GstA | 812..1000 | CDD:223698 | 55/209 (26%) | ||
| GST_C_Delta_Epsilon | 900..1017 | CDD:198287 | 22/114 (19%) | ||
| Gstt2 | XP_011241675.1 | GST_N_Theta | 3..85 | CDD:239348 | 28/81 (35%) |
| GST_C_Theta | 98..223 | CDD:198292 | 22/114 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1231780at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000035 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X30 | |
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 6 | 5.820 | |||||