DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GSTO2

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:232 Identity:56/232 - (24%)
Similarity:94/232 - (40%) Gaps:53/232 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   807 VPIYTMKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGF 871
            ||...:::|::...|.|...|:.|||.||:::::|::   :.::.|.|...:|...||||:....
Human    19 VPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNIN---LRNKPEWYYTKHPFGHIPVLETSQC 80

  Fly   872 YL-SESIAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYK--R 933
            .| .||:...:||.|.| |...|:|.|...||  .|::...: |...|   |.........:  |
Human    81 QLIYESVIACEYLDDAY-PGRKLFPYDPYERA--RQKMLLEL-FCKVP---HLTKECLVALRCGR 138

  Fly   934 TPMSLK-KVQNALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQFTLVNKWYE 997
            ...:|| .::......|..|:...|.:..|..|::.|:                    |:..|:|
Human   139 ECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDY--------------------LLWPWFE 183

  Fly   998 TFKV--------EYP--QLWEIANSGMQEISAFEQNP 1024
            ...|        ..|  :||         |||.:.:|
Human   184 RLDVYGILDCVSHTPALRLW---------ISAMKWDP 211

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 22/75 (29%)
GstA 812..1000 CDD:223698 46/191 (24%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 22/129 (17%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 23/77 (30%)