DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2656 and QQT1

DIOPT Version :9

Sequence 1:NP_649699.1 Gene:CG2656 / 40857 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001119261.1 Gene:QQT1 / 832298 AraportID:AT5G22370 Length:298 Species:Arabidopsis thaliana


Alignment Length:304 Identity:115/304 - (37%)
Similarity:165/304 - (54%) Gaps:54/304 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRFAQIIVGPAGSGKSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNPLTDIRDLIHLDDAMED 65
            |.|.|:::||.||||:|||:.|.|:.....|.|.:||||||.:...|....:|.:||.|:|.|.:
plant     1 MVFGQVVIGPPGSGKTTYCNGMSQFLSLMGRKVAIVNLDPANDALPYECGVNIEELIKLEDVMSE 65

  Fly    66 EELHYGPNGGLIFCLEFLIENQEWLKEQLCGGENELMVGEP--DDDYILFDMPGQIEL-FTHLKM 127
            ..|  ||||||::|:|:|.:|.:||:.:|          :|  .|.|||||.|||:|| |.|...
plant    66 HSL--GPNGGLVYCMEYLEKNIDWLESKL----------KPLLKDHYILFDFPGQVELFFIHDST 118

  Fly   128 GRQLVELLESWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDLLSSDAR 192
            ...|.:|::|.|.|...|..:||....|...::|..:.:||.|.:||.||:|||:|:||:.|..:
plant   119 KNVLTKLIKSLNLRLTAVQLIDSHLCCDPGNYVSSLLLSLSTMLHMELPHVNVLSKIDLIGSYGK 183

  Fly   193 --------------KQLEMYLEPDAHSLMGELTIGTGFGEKYAKLTQAIGALIEDFSLVRFFPLD 243
                          ..||.:|..|..|            .||.|||:.:.::|||:|||.|..||
plant   184 LAFNLDFYTDVQDLSYLEHHLSQDPRS------------AKYRKLTKELCSVIEDYSLVNFTTLD 236

  Fly   244 SQDEESVGDLLLQID------------SILQYGEDADVNVKDFD 275
            .||:||||||:..||            |:::|.:.| :...|:|
plant   237 IQDKESVGDLVKLIDKSNGYIFAGIDASVVEYSKIA-IGQTDWD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 80/210 (38%)
ATP_bind_1 7..263 CDD:281079 108/284 (38%)
QQT1NP_001119261.1 ATP_bind_1 7..256 CDD:308588 107/272 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D964931at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.