DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2656 and gpn2

DIOPT Version :9

Sequence 1:NP_649699.1 Gene:CG2656 / 40857 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_999966.2 Gene:gpn2 / 407722 ZFINID:ZDB-GENE-041010-86 Length:311 Species:Danio rerio


Alignment Length:265 Identity:108/265 - (40%)
Similarity:152/265 - (57%) Gaps:13/265 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRFAQIIVGPAGSGKSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNPLTDIRDLIHLDDAMED 65
            :||.|:::||.||||:|||..||::.....|.|.:||||||.|...|....||.:|:.|||.|:.
Zfish     9 LRFGQVVIGPPGSGKTTYCRGMQEFLSRLGRKVVIVNLDPANEGLPYPCAVDIAELVTLDDVMDG 73

  Fly    66 EELHYGPNGGLIFCLEFLIENQEWLKEQLCGGENELMVGEPDDDYILFDMPGQIELFTHLKMGRQ 130
              |..|||||||:.:|:|..|.:||       ||:|.:..  |.|.|||.|||:||:||....:.
Zfish    74 --LKLGPNGGLIYSMEYLEANLDWL-------ENKLKLHH--DCYFLFDCPGQVELYTHHNSVKN 127

  Fly   131 LVELLESWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDLLSSDARK-- 193
            :...|..||||...|..:||.:..|.|||||....:||.|.::|.||:|||:|:||:....:.  
Zfish   128 IFAQLSKWNFRLTAVHLVDSHYCADPAKFISVLCTSLSTMLHVELPHVNVLSKMDLIEQYGKLAF 192

  Fly   194 QLEMYLEPDAHSLMGELTIGTGFGEKYAKLTQAIGALIEDFSLVRFFPLDSQDEESVGDLLLQID 258
            .|:.|.|....|.:.|......|.:|:..|...:..:|:|:|||.|.||:.||:||:..:|..:|
Zfish   193 NLDFYTEVLDLSYLVEHLSADPFFKKFHHLNVKLAEVIQDYSLVSFVPLNVQDKESMMQVLRTVD 257

  Fly   259 SILQY 263
            ....|
Zfish   258 KANGY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 85/195 (44%)
ATP_bind_1 7..263 CDD:281079 104/257 (40%)
gpn2NP_999966.2 Gem1 14..183 CDD:224025 80/179 (45%)
ATP_bind_1 15..262 CDD:281079 104/257 (40%)
Gly-Pro-Asn (GPN)-loop, involved in dimer interface. /evidence=ECO:0000250|UniProtKB:Q9UYR9 77..79 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432496at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.