DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2656 and CG10222

DIOPT Version :9

Sequence 1:NP_649699.1 Gene:CG2656 / 40857 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001287060.1 Gene:CG10222 / 39504 FlyBaseID:FBgn0036356 Length:307 Species:Drosophila melanogaster


Alignment Length:278 Identity:102/278 - (36%)
Similarity:152/278 - (54%) Gaps:19/278 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RFAQIIVGPAGSGKSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNPLTDIRDLIHLDDAMEDE 66
            |:.|:|:||.||||:|||....::..:..|.|.|||||||.|:.:|.|:..:.:||.::|.|  |
  Fly    15 RYGQLIIGPPGSGKTTYCGEALKFYRELGRQVGVVNLDPANENMSYEPVLSVMELITVEDCM--E 77

  Fly    67 ELHYGPNGGLIFCLEFLIEN-QEWLKEQLCGGENELMVGEPDDDYILFDMPGQIELFTHLKMGRQ 130
            .|..||||.|:.|.|:|.:: ::||...|    .:|   ....:|.|||.|||:||:||.....:
  Fly    78 HLKLGPNGALMHCAEYLADHLEDWLLPAL----RKL---SATYNYFLFDCPGQVELYTHHNAMAR 135

  Fly   131 LVELLESWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDLLSSDARK-- 193
            :.|.||...:....|..:||.:..:.||||:..:.||:.|..|..||:|||:|.|||.....|  
  Fly   136 IFERLERERYSLVTVNLIDSHYCSEPAKFIATLLMALNTMLRMSLPHVNVLSKADLLKKHETKLH 200

  Fly   194 -QLEMYLEP-DAHSLMGELTIGTGFGEKYAKLTQAIGALIEDFSLVRFFPLDSQDEESVGDLLLQ 256
             .::.|.:. |...|:.:|...... .||.||..||.:::||::||.|..||....:|:..|...
  Fly   201 FNVDYYTDVLDLKYLLDKLDDDPAM-RKYRKLNAAICSMVEDYALVSFQLLDVFSTDSMLRLRNH 264

  Fly   257 IDS----ILQYGEDADVN 270
            ||.    :.:.||:..||
  Fly   265 IDKANGYVYKAGEEQTVN 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 77/197 (39%)
ATP_bind_1 7..263 CDD:281079 96/264 (36%)
CG10222NP_001287060.1 Gem1 19..193 CDD:224025 73/182 (40%)
ATP_bind_1 20..271 CDD:281079 96/260 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473009
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100312at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.