DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2656 and Gpn2

DIOPT Version :9

Sequence 1:NP_649699.1 Gene:CG2656 / 40857 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001257888.1 Gene:Gpn2 / 362614 RGDID:1311749 Length:310 Species:Rattus norvegicus


Alignment Length:265 Identity:102/265 - (38%)
Similarity:146/265 - (55%) Gaps:17/265 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FAQIIVGPAGSGKSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNPLTDIRDLIHLDDAMEDEE 67
            |.|.::||.||||:|||..|.::.....|.|.|||||||.|...|....|:.:|:.|.|.|  :.
  Rat    10 FGQAVIGPPGSGKTTYCLGMSEFLRALGRRVAVVNLDPANEGLPYECAVDVGELVGLGDVM--DA 72

  Fly    68 LHYGPNGGLIFCLEFLIENQEWLKEQLCGGENELMVGEP-DDDYILFDMPGQIELFTHLKMGRQL 131
            |..||||||::|:|:|..|.:||:.:|          || ...|.|||.|||:||.||....|.:
  Rat    73 LRLGPNGGLLYCMEYLEANLDWLRAKL----------EPLRGHYFLFDCPGQVELCTHHTSLRSI 127

  Fly   132 VELLESWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDLLSSDARK--Q 194
            ...:..|:.|...|..:||.:..|.|||||....:|:.|.::|.||:|:|:|:||:....:.  .
  Rat   128 FSQMAQWDLRLTAVHLVDSHYCTDPAKFISVLCTSLATMLHVELPHVNLLSKMDLIEHYGKLAFN 192

  Fly   195 LEMYLEP-DAHSLMGELTIGTGFGEKYAKLTQAIGALIEDFSLVRFFPLDSQDEESVGDLLLQID 258
            |:.|.|. |...|:..|. ...|...|.:|.:.:..||||:|||.|.||:.||::|:..:|..:|
  Rat   193 LDYYTEVLDLSYLLDHLA-SDPFFSHYRQLNEKLVQLIEDYSLVSFIPLNIQDKDSIQRVLQAVD 256

  Fly   259 SILQY 263
            ....|
  Rat   257 KANGY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 77/195 (39%)
ATP_bind_1 7..263 CDD:281079 99/259 (38%)
Gpn2NP_001257888.1 Gem1 13..182 CDD:224025 73/180 (41%)
ATP_bind_1 14..261 CDD:281079 99/259 (38%)
Gly-Pro-Asn (GPN)-loop, involved in dimer interface. /evidence=ECO:0000250|UniProtKB:Q9UYR9 76..78 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432496at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.