DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14610 and CG12883

DIOPT Version :9

Sequence 1:NP_649698.2 Gene:CG14610 / 40856 FlyBaseID:FBgn0037477 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_651579.1 Gene:CG12883 / 43326 FlyBaseID:FBgn0039538 Length:157 Species:Drosophila melanogaster


Alignment Length:150 Identity:60/150 - (40%)
Similarity:86/150 - (57%) Gaps:14/150 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPSSEKQSYEELM------ENMKLCEAERIYALSNSVGRILDDAEARKILRHFMKS-----ENK 54
            ||.||.|....:|:      .||.:.|..|||.|||||...|.||||.::||.||::     :::
  Fly     1 MASSSSKNKTLQLIRCFCGCSNMTVAEVRRIYVLSNSVHETLLDAEATRLLRKFMETRRSGDKDE 65

  Fly    55 SMQCVDIYEKCAEFLVEHPK-YESCHFEVLVRLGLPSHLKQRLFYRLNNADPISICLCLKHIQEE 118
            :.|.:||||||||||.||.: :.....:.||.||||..|:|.|..|:.:||...|...|..||.:
  Fly    66 AEQYLDIYEKCAEFLAEHQRTFTQDEVDELVDLGLPYDLEQDLSRRMLSADRTDISSGLYRIQSK 130

  Fly   119 CLSEV--AESFSAFKESITE 136
            |.:|:  :..|..|:::|.:
  Fly   131 CRNEIEGSSDFRDFRDAIAD 150



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453084
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019574
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.