DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31248 and AgmNAT

DIOPT Version :9

Sequence 1:NP_001262333.1 Gene:CG31248 / 40853 FlyBaseID:FBgn0051248 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_572268.1 Gene:AgmNAT / 31512 FlyBaseID:FBgn0029813 Length:216 Species:Drosophila melanogaster


Alignment Length:213 Identity:42/213 - (19%)
Similarity:79/213 - (37%) Gaps:43/213 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VRSVTHSDLEEALDVLDGSFFLNESVCVACEINLPENRQARLDLRELCRKTALDGVSLLVKEADT 83
            ||.|...:.|:.:..|...::..|.:........||.......|..:...|..  |:|     ..
  Fly    11 VRQVDVGETEQLMTFLLAHYYPEEPLTAGTHPPEPEAADKEFLLSNVPFGTCF--VAL-----HE 68

  Fly    84 GRVVSVSFNKIQYAPPPGEDHFFLKFRNEEVKSPQARR--------LMDFMIEVDGRIDVCAMFN 140
            ||:|:.      ....|.:.|      ..|..:.:||:        ::..:..|:...|||..|:
  Fly    69 GRIVAA------VVAGPKDSH------EPEHMAEEARKYAGGKWGSILHLLSAVETATDVCRRFS 121

  Fly   141 MVCFCELMFLATLPSHERLGLGRSLSQFTIELTKELAEGKGLEDIDDKLRSKRPAAVTALWTSRF 205
            :.....:..|...|......||..|.:...:..::|  |..|..:|          .|:::::|.
  Fly   122 VPSCLHVHALGVDPQLRGRNLGGRLMETVAQRGRDL--GHQLVSVD----------CTSVYSARL 174

  Fly   206 SQKVGKATDFKVINTVSY 223
            .|::|    :::|||:.|
  Fly   175 VQRLG----YQLINTLRY 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31248NP_001262333.1 None
AgmNATNP_572268.1 Acetyltransf_1 33..180 CDD:306954 33/181 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435041
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.