DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31248 and M7.12

DIOPT Version :9

Sequence 1:NP_001262333.1 Gene:CG31248 / 40853 FlyBaseID:FBgn0051248 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_502070.2 Gene:M7.12 / 187458 WormBaseID:WBGene00010887 Length:241 Species:Caenorhabditis elegans


Alignment Length:258 Identity:49/258 - (18%)
Similarity:96/258 - (37%) Gaps:73/258 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KFEVRSVTHSDLEEALDVLDGSFFLNESVCVACEINLPENRQARLDLRELCRKTALDG------- 73
            |:...:|.|.:..|.:|.|:.:|.:.|          |.::.|.:...::  ::..||       
 Worm    23 KYYFETVKHDNRNEVVDFLNNNFRVEE----------PLSKAAGMTESDI--QSCFDGVFERVLK 75

  Fly    74 --VSLLVKEADTGRVVSVSFNKIQYAPPPGEDHFFLKFRNEEVKSPQARRLMDFMIEVDGRIDVC 136
              ||:|.:...:..:|....|.:..             ||:..|:.......:|..:..|.:.:.
 Worm    76 NEVSILARSKQSDEIVGCMLNSVWK-------------RNDPKKNEDEAEDFEFGGDRKGVMTIG 127

  Fly   137 AMFNMV--CFCELM----------FLATLPSHERLGLGRSLSQFTIELTKELAEGKGLEDIDDKL 189
            .:.|.:  .|.:|.          ..:...:|:|.||......:|.:  |||            |
 Worm   128 EILNELHESFWKLRPDQHTVLHFEISSVNKNHQRQGLASKFMNWTEK--KEL------------L 178

  Fly   190 RSKRPAAVTALWTSRFSQ----KVGKATDFKVINTVSYSEFEYKGKRF------DERINLIHK 242
            :|...:::.|..:|..:|    |.|..|   |.:|:..|..:..||:.      .:|::|:.|
 Worm   179 KSVEASSIVAEASSLANQILLSKRGYET---VASTLLSSRIDVNGKQILVCDDGTDRVDLVFK 238



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.