DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31248 and M7.8

DIOPT Version :9

Sequence 1:NP_001262333.1 Gene:CG31248 / 40853 FlyBaseID:FBgn0051248 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_502069.1 Gene:M7.8 / 187457 WormBaseID:WBGene00010884 Length:230 Species:Caenorhabditis elegans


Alignment Length:255 Identity:54/255 - (21%)
Similarity:90/255 - (35%) Gaps:69/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FEVRSVTHSDLEEALDVLDGSFFLNESVCVACEINLPENRQARLDLREL--CRKTALDGV----- 74
            |||  :.:.:..|.|..|..||.::|          |.||.:::...|:  |...|||..     
 Worm    14 FEV--LRNEEKSEMLKFLLESFRVDE----------PLNRASKISCEEIEKCLDGALDRALKTES 66

  Fly    75 SLLVKEADTGRVVSVSFNKI----QYAPPPGEDHFFLKFRNEEVKSPQARRLMDFMIEVDGRI-- 133
            |:|.:..||..:|....|.:    :....|||:....:|.....:......:::.:.|....:  
 Worm    67 SILARSQDTHEIVGCMLNSVWRRDESLCTPGEEDKDFEFHTIRKEVAMVAEILNELHESFWSLRP 131

  Fly   134 --DVCAMFNMVCFCELMFLATLPSHERLGLGRSLSQFTIELTKELAEGKGLEDI--------DDK 188
              ||...|      |:..::.  :|.|.||......:|  ..|:..:..|...|        :..
 Worm   132 DQDVVLHF------EISSVSV--NHRRQGLASKFMNWT--ENKKFLDTFGATGIATEASSLANQA 186

  Fly   189 LRSKRPAAVTALWTSRFSQKVGKATDFKVINTVSYSEFEYKGKRF------DERINLIHK 242
            |.:||..:..|  |:....||...|                ||..      .:|:||:.|
 Worm   187 LLAKRGYSTIA--TTLLDTKVDPDT----------------GKPILVCDDGTDRVNLMFK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31248NP_001262333.1 None
M7.8NP_502069.1 Acetyltransf_1 82..193 CDD:306954 21/120 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.