DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31248 and T10B5.4

DIOPT Version :9

Sequence 1:NP_001262333.1 Gene:CG31248 / 40853 FlyBaseID:FBgn0051248 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001300192.1 Gene:T10B5.4 / 178668 WormBaseID:WBGene00020390 Length:237 Species:Caenorhabditis elegans


Alignment Length:246 Identity:46/246 - (18%)
Similarity:82/246 - (33%) Gaps:73/246 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TLHDGKFEVRSVTHSDLEEALDVLDGSFFLNESVCVACEINLPENRQARLDLRELCRKTALDGV- 74
            |...|..|.:...|..|.|...|::.         :...::..|.     |:.|......:.|: 
 Worm     5 TFQTGLLEHKDQVHKFLVEHFRVMEP---------ITTSLSCSEE-----DVAEFFVDLTMSGLE 55

  Fly    75 ----SLLVKEADTGRVVSVSFNKIQYA-----PPPGEDH--FFLKFRNEEVKSPQARRLMDF--M 126
                |:||.:.:  .:|:|..|.::..     ..|...|  |..:..|.:.|...|.:|:.|  :
 Worm    56 DEKSSILVFDGE--EIVAVCLNAVKECSFVSESTPFNPHWDFNAEITNGQYKHENANKLVAFVQV 118

  Fly   127 IEVD-----------GRIDVCAMFNMVCFCELMFLATLPSHERLGLGRSLSQFTIE-LTKELAEG 179
            :|.|           .:|||..: :..|             :..|:||.|.:.::| ..||..| 
 Worm   119 LEQDLSFLTGNPKKVFKIDVLCV-SKAC-------------QGKGIGRQLVEKSLENAVKEDCE- 168

  Fly   180 KGLEDIDDKLRSKRPAAVTALWTSRFSQKVGKATDFKVINTVSYSEFEYKG 230
                            .|..:.|:..||.:........:..:.:|.|...|
 Worm   169 ----------------YVATVATAVASQNIFSKCGLTTLREMPFSCFRNNG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31248NP_001262333.1 None
T10B5.4NP_001300192.1 Acetyltransf_1 <110..187 CDD:366181 20/107 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155943
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.