DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31248 and anat-1

DIOPT Version :9

Sequence 1:NP_001262333.1 Gene:CG31248 / 40853 FlyBaseID:FBgn0051248 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001076662.1 Gene:anat-1 / 177439 WormBaseID:WBGene00015938 Length:285 Species:Caenorhabditis elegans


Alignment Length:272 Identity:54/272 - (19%)
Similarity:99/272 - (36%) Gaps:83/272 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TLHDGKFEVRSVTHSDLEEALDVLDGSFFLNESVCVACEINLPENRQARLDLREL---------- 65
            |.:..:::|.||..|:|||.:..|..:|...|::..:.:|:     ..::.|:||          
 Worm    57 TANRQQYQVESVKESNLEEIVQFLIDNFAQTEAILASLKID-----DDKICLKELTVMLRDLVQD 116

  Fly    66 ---CRKTA---------LDGVSLLVKEADTGRVVSVSFNK-----IQYAPPPGEDHFFLKFRNEE 113
               |..|.         :||::|..|.:        .|:|     ..|           :||.:.
 Worm   117 SLQCSSTCVIRDVTTRQIDGIALACKTS--------IFDKQIDRLCAY-----------EFREQR 162

  Fly   114 VKSPQARRLMDFMIEVDGRIDVCAMFNMVCFCELMFLATLPSHERL---GLGRSLSQFTIELTKE 175
            |     |..::|:..|..::||....|.....:.:|:|.:...:.|   |:|.:|          
 Worm   163 V-----RDAVEFLKYVFNKLDVMYYLNEHRLYKPVFVALVCVRKELWGRGIGTTL---------- 212

  Fly   176 LAEGKGLEDIDDKLRSKRPAAVTALWTSRFSQKVGKA---TDFKVINTVSYSEFEYKGKRFDERI 237
                  :..:....|:.....:.:|.::....|:.|.   |||.   .|.|..|  ||:.....|
 Worm   213 ------MNHVKSAARTDSSDGLISLCSNERGHKLMKTYCPTDFA---AVRYDAF--KGEHLRPPI 266

  Fly   238 NLIHKFCEHVIY 249
            .:......|.:|
 Worm   267 VMRPPETFHSVY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31248NP_001262333.1 None
anat-1NP_001076662.1 NAT_SF <192..221 CDD:173926 6/44 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.