powered by:
Protein Alignment CG10098 and ARC35
DIOPT Version :9
Sequence 1: | NP_649694.1 |
Gene: | CG10098 / 40851 |
FlyBaseID: | FBgn0037472 |
Length: | 353 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_014433.1 |
Gene: | ARC35 / 855771 |
SGDID: | S000005318 |
Length: | 342 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 91 |
Identity: | 22/91 - (24%) |
Similarity: | 30/91 - (32%) |
Gaps: | 25/91 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 264 PNAAESV--FKPFVFAPNPRISPLTQVQAEADLTLLHK------------LHSQRKPAALEHLRS 314
|..||.. |..||..|....:...|..:...|||... :||:.:......::.
Yeast 244 PKVAEQSRRFITFVLFPRHFQTKELQFHSICQLTLFRNYFHYHIKCSKAYMHSRMRFRVDSFIKV 308
Fly 315 LELSCVDELNNYFSLQDHASDELDEL 340
|..:.||| .||.|||
Yeast 309 LNRAKVDE-----------DDENDEL 323
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10098 | NP_649694.1 |
Ntn_hydrolase |
73..>169 |
CDD:294319 |
|
ARC35 | NP_014433.1 |
P34-Arc |
56..316 |
CDD:397935 |
15/71 (21%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4690 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.