DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10098 and Arpc2

DIOPT Version :9

Sequence 1:NP_649694.1 Gene:CG10098 / 40851 FlyBaseID:FBgn0037472 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001344316.1 Gene:Arpc2 / 76709 MGIID:1923959 Length:300 Species:Mus musculus


Alignment Length:128 Identity:26/128 - (20%)
Similarity:48/128 - (37%) Gaps:22/128 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 GPKP-AGDGTYTQHDMFETLRSASNASSSRA---ATVSVLSVKGISCHWFTGTPNAAESVFKPFV 275
            |.|| |.:.|:...|  ..|...||.:..:.   .::|:...|.:..|   |.....:.|:..|:
Mouse    25 GNKPEAVEVTFADFD--GVLYHISNPNGDKTKVMVSISLKFYKELQAH---GADELLKRVYGSFL 84

  Fly   276 FAPNPRISPLTQVQAEADLTLLHKLHS--QRKPAALEHLRSLELSC-VDELNNYFSLQDHASD 335
            ..|.|..          :::||:.|.:  ..|.:.:.....|:.:| ......||..|:...:
Mouse    85 VNPEPGY----------NVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKE 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10098NP_649694.1 Ntn_hydrolase 73..>169 CDD:294319
Arpc2NP_001344316.1 P34-Arc 57..284 CDD:367780 17/94 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4690
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.