DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alh and SNT2

DIOPT Version :9

Sequence 1:NP_001262332.1 Gene:Alh / 40850 FlyBaseID:FBgn0261238 Length:1717 Species:Drosophila melanogaster
Sequence 2:NP_011384.1 Gene:SNT2 / 852746 SGDID:S000003099 Length:1403 Species:Saccharomyces cerevisiae


Alignment Length:245 Identity:68/245 - (27%)
Similarity:104/245 - (42%) Gaps:64/245 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CCVCSDERGWPENPLVYCDGQNCTVAVHQACYGI---------VTVPTGPWYCRKCESQER---T 113
            |.||.::....:|..|.|.  ||.:.||..||.|         ..:.|..|.|..|.:...   :
Yeast  1041 CSVCKEKFNDNDNYEVVCG--NCGLTVHYFCYAIKLPKDMKKNTNLKTFKWLCDPCSNDLNPIIS 1103

  Fly   114 SRVRCELCPSRD---------------GALKKTDNSGWAHVVCALYIPEVRFGNVTTMEPIILS- 162
            :..:|.:||::|               .|||.|....|.|:||:|:..::::||..:|:|.:.: 
Yeast  1104 TTYQCSMCPTKDYDYDRYRSQSFKICPDALKCTSLGTWVHLVCSLFNEDIKYGNGQSMQPALNTT 1168

  Fly   163 --LIPQERYSKTCYICQEIGKPNRANVGACMQCNKSNCKQQFHVTCAQ---SLGLLCEEAGNYLD 222
              ||...|:  ||.:|       |.|.|..::|||  |:.::|:||||   :..|:.|:....:|
Yeast  1169 AVLIKHSRF--TCGVC-------RINGGGLVKCNK--CQYRYHITCAQNSSNFKLMFEKKNMSVD 1222

  Fly   223 NVKYC--------GY-------CQHHYSKLKKGGNVKTIPPYKPIQHDTS 257
            ....|        .|       |..|...|:  ||......||| ||..|
Yeast  1223 TTLPCIKDVKLNDTYTLRPILICDRHDISLE--GNELYPLSYKP-QHTLS 1269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlhNP_001262332.1 PHD_AF10_AF17 60..107 CDD:277049 16/54 (30%)
ePHD_AF10_like 118..233 CDD:277142 41/150 (27%)
SNT2NP_011384.1 BAH_fungalPHD 112..256 CDD:240061
PHD1_Snt2p_like 319..366 CDD:276972
Myb_DNA-binding 559..602 CDD:395191
PHD2_Snt2p_like 1040..1094 CDD:276973 16/54 (30%)
ePHD_Snt2p_like 1108..1248 CDD:277137 41/150 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3355
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.