DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alh and SDG29

DIOPT Version :9

Sequence 1:NP_001262332.1 Gene:Alh / 40850 FlyBaseID:FBgn0261238 Length:1717 Species:Drosophila melanogaster
Sequence 2:NP_200155.2 Gene:SDG29 / 835424 AraportID:AT5G53430 Length:1043 Species:Arabidopsis thaliana


Alignment Length:333 Identity:93/333 - (27%)
Similarity:131/333 - (39%) Gaps:73/333 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KKFKLDDMKEMVGGCCVCSDERGWPENPLVYCDGQNCTVAVHQACYGIVTV-PTGPWYCRKCESQ 110
            :|::..::|.....|.||.....|..|.::.|:  .|.:||||.|||...| ....|.|:.||:.
plant   596 EKYEPVNVKWTTERCAVCRWVEDWDYNKIIICN--RCQIAVHQECYGTRNVRDFTSWVCKACETP 658

  Fly   111 ERTSRVRCELCPSRDGALKKTD-NSGWAHVVCALYIPEVRFGNVTTMEPI--ILSLIPQERYSKT 172
            |  .:..|.|||.:.||||.|| .:.|.||.||.:.|||.|.:...|||.  ||| ||...:.|.
plant   659 E--IKRECCLCPVKGGALKPTDVETLWVHVTCAWFQPEVCFASEEKMEPALGILS-IPSSNFVKI 720

  Fly   173 CYICQEIGKPNRANVGACMQCNKSNCKQQFHVTCAQSLG----LLC-EEAGNYLDNVKYCGYCQH 232
            |.||::|.       |:|.||.|  |...:|..||...|    |.| |:.|..:  .|...||.:
plant   721 CVICKQIH-------GSCTQCCK--CSTYYHAMCASRAGYRMELHCLEKNGRQI--TKMVSYCSY 774

  Fly   233 HYSKLKKGGNVKTIPPYKPIQHDTSSDSCSSPEKEIDSTMNSATTSATIIKITSSSGSAGGSSNV 297
            |                                        .|....|::.|.:.||.....|.|
plant   775 H----------------------------------------RAPNPDTVLIIQTPSGVFSAKSLV 799

  Fly   298 LNASSSAGISAGSSSGSGVSSSAKQRKSNASSKSSS-------SSSSSSSSSTGGAPNPSSSSVH 355
            .|...| |.....::...:..||.:........||:       :.:|...:...|.|:.:....|
plant   800 QNKKKS-GTRLILANREEIEESAAEDTIPIDPFSSARCRLYKRTVNSKKRTKEEGIPHYTGGLRH 863

  Fly   356 SGSASNMT 363
            ..||:..|
plant   864 HPSAAIQT 871

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlhNP_001262332.1 PHD_AF10_AF17 60..107 CDD:277049 17/47 (36%)
ePHD_AF10_like 118..233 CDD:277142 49/122 (40%)
SDG29NP_200155.2 PWWP 221..324 CDD:295359
PHD_TCF19_like 415..466 CDD:276992
PHD_ATX3_4_5_like 609..655 CDD:276970 17/47 (36%)
ePHD_ATX3_4_5_like 664..775 CDD:277133 49/122 (40%)
SET 901..1024 CDD:214614
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.