DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alh and AT3G14740

DIOPT Version :9

Sequence 1:NP_001262332.1 Gene:Alh / 40850 FlyBaseID:FBgn0261238 Length:1717 Species:Drosophila melanogaster
Sequence 2:NP_974313.1 Gene:AT3G14740 / 820702 AraportID:AT3G14740 Length:343 Species:Arabidopsis thaliana


Alignment Length:245 Identity:78/245 - (31%)
Similarity:126/245 - (51%) Gaps:34/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SSFNAKLELDSSKDDTIHSTS-LNK-KLVKIKKFKLDDMKEMVGGCCVCSDERGWPENPLVYCDG 80
            |:.|.:..|:..:||...:.. |.| |.:.:...:::|...::  |.||....|.|.||:|:|||
plant   110 STLNVESSLEVEEDDDKENIDPLGKGKALDLSDREVEDEDGIM--CAVCQSTDGDPLNPIVFCDG 172

  Fly    81 QNCTVAVHQACYG---IVTVPTGPWYCRKCESQERTSRV-RCELCPSRDGALKKTDNSGWAHVVC 141
              |.:.||.:|||   :..:|.|.|:||:|.|.:...:: .|.||.::.||:|.|::..|||:.|
plant   173 --CDLMVHASCYGNPLVKAIPEGDWFCRQCLSSKNREKIFSCCLCTTKGGAMKPTNDGRWAHITC 235

  Fly   142 ALYIPEVRFGNVTTMEPIILSLIPQERYSKTCYICQEIGKPNRANVGACMQCNKSNCKQQFHVTC 206
            ||::|||.|.:....|.|..|.:..:|:...||:|       :...|..::|::..||..|||||
plant   236 ALFVPEVYFEDPEGREGICCSEVLSKRWKDRCYLC-------KVRRGCVIECSEMRCKLAFHVTC 293

  Fly   207 AQSLGL---LCEEAGNYLDNVK----YCGYCQHH---YSKLKKGGNVKTI 246
                ||   ||.|   |.:..|    ..|:|..|   :.:.::.|..|.:
plant   294 ----GLKEDLCIE---YREGKKSGGIVVGFCNEHTKLWERQQESGKYKIV 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlhNP_001262332.1 PHD_AF10_AF17 60..107 CDD:277049 22/49 (45%)
ePHD_AF10_like 118..233 CDD:277142 42/121 (35%)
AT3G14740NP_974313.1 COG5141 <144..>323 CDD:227470 68/196 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3222
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13793
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.