DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alh and brpf3

DIOPT Version :9

Sequence 1:NP_001262332.1 Gene:Alh / 40850 FlyBaseID:FBgn0261238 Length:1717 Species:Drosophila melanogaster
Sequence 2:XP_031751953.1 Gene:brpf3 / 779492 XenbaseID:XB-GENE-6092087 Length:992 Species:Xenopus tropicalis


Alignment Length:280 Identity:95/280 - (33%)
Similarity:135/280 - (48%) Gaps:61/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IPSSF-----------NAKLELDSSKDDTIHSTSLNKK-------LVKIKKFKL--------DDM 54
            :|.||           :.::|.|..:.|......:|:|       ||....|:|        ..|
 Frog   146 LPDSFYCYIERSTKEMDQEVEYDLDEVDLAWLEMINEKRKNDGLSLVSADVFELLLDRLEKESYM 210

  Fly    55 KEMVGG-----------CCVCSDERGWPENPLVYCDGQNCTVAVHQACYGIVTVPTGPWYCRKCE 108
            :....|           ||||.|:.....|.:::||  .|.:||||.|||:..:|.|.|.||.| 
 Frog   211 QSRRSGAPQSAIDEDAFCCVCLDDECHNSNAILFCD--ICNLAVHQECYGVPYIPEGQWLCRCC- 272

  Fly   109 SQERTSRVRCELCPSRDGALKKTDNSGWAHVVCALYIPEVRFGNVTTMEPII-LSLIPQERYSKT 172
            .|..:..|.|.|||::.||.|:|.:..|||||||::||||.|.|...:||:. ::.||..|:..|
 Frog   273 LQSPSKPVSCVLCPNQGGAFKQTSDGRWAHVVCAIWIPEVCFANTVFLEPVEGVNNIPSARWKLT 337

  Fly   173 CYICQEIGKPNRANVGACMQCNKSNCKQQFHVTCAQSLGLLCE-----EAG--NYLDNVKYCGYC 230
            ||:|::.|:      ||.:||:|.||...|||||||..||..:     |.|  .....|:...:|
 Frog   338 CYLCKQKGR------GAAIQCHKVNCYTAFHVTCAQRAGLFMKVEPVRETGLNGTTFTVRKTAFC 396

  Fly   231 QHH-----YSK--LKKGGNV 243
            :.|     :.|  |:.||.|
 Frog   397 ELHCPPGTHKKGILRCGGKV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlhNP_001262332.1 PHD_AF10_AF17 60..107 CDD:277049 22/57 (39%)
ePHD_AF10_like 118..233 CDD:277142 51/122 (42%)
brpf3XP_031751953.1 EPL1 58..207 CDD:402235 12/60 (20%)
COG5141 165..610 CDD:227470 92/261 (35%)
PHD_SF 282..399 CDD:419867 51/122 (42%)
Bromodomain 585..682 CDD:413371
BR140_related 860..976 CDD:99900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D566217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1726
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.