DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alh and Kdm4c

DIOPT Version :9

Sequence 1:NP_001262332.1 Gene:Alh / 40850 FlyBaseID:FBgn0261238 Length:1717 Species:Drosophila melanogaster
Sequence 2:NP_001165566.1 Gene:Kdm4c / 76804 MGIID:1924054 Length:1071 Species:Mus musculus


Alignment Length:277 Identity:90/277 - (32%)
Similarity:133/277 - (48%) Gaps:43/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DSSKD--DTIHSTSLNKKLVKIKKFKLDDMKEMVGGCCVCSDER--GWPENPLVYCDGQN----- 82
            ||||:  |:...|::|:.:...:|.| ..:.||   |.:.|:|.  ..|.|..:..||.:     
Mouse   673 DSSKEENDSRWETAVNEVVQSGRKTK-PIIPEM---CFIYSEENVDYSPPNAFLEEDGTSLLISC 733

  Fly    83 --CTVAVHQACYGIVT--VPTGPWYCRKCESQERTSRVRCELCPSRDGALKKTDNSGWAHVVCAL 143
              |.|.||.:|||:.:  |..| |.|.:|:....|:  .|.||..|.||||:|.|:.||||:||:
Mouse   734 AKCFVRVHASCYGVPSHEVCDG-WLCARCKRNAWTA--ECCLCNLRGGALKQTKNNQWAHVICAV 795

  Fly   144 YIPEVRFGNVTTMEPIILSLIPQERYSKTCYICQ-EIGKPNRANVGACMQCNKSNCKQQFHVTCA 207
            .:|||||.||.....|.:..||.:|....|..|: .:.|.:    |||:||:...|...||||||
Mouse   796 AVPEVRFTNVPERTQIDVDRIPLQRLKLKCIFCRHRVKKVS----GACIQCSYGRCPASFHVTCA 856

  Fly   208 QSLGLLCE-EAGNYLDNVKYCGYCQHHYSKLKKGGNVKTIPPYKPIQHDTSSDSCSSPEKEIDST 271
            .:.|:|.| :...|:.|:.    |..|    :...|.|:         .|...:.|..:..|...
Mouse   857 HAAGVLMEPDDWPYVVNIT----CFRH----RVNSNAKS---------KTCEKAISVGQTVITKH 904

  Fly   272 MNSATTSATIIKITSSS 288
            .|:...|..:|.:||.:
Mouse   905 RNTRYYSCRVIDVTSQT 921

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlhNP_001262332.1 PHD_AF10_AF17 60..107 CDD:277049 18/57 (32%)
ePHD_AF10_like 118..233 CDD:277142 48/116 (41%)
Kdm4cNP_001165566.1 JmjN 33..74 CDD:301729
JmjC 194..310 CDD:202224
PHD_SF 660..761 CDD:304600 29/92 (32%)
PHD_SF 770..879 CDD:304600 48/116 (41%)
TUDOR 892..948 CDD:197660 7/30 (23%)
TUDOR 950..1005 CDD:197660
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.