DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alh and kdm4b

DIOPT Version :9

Sequence 1:NP_001262332.1 Gene:Alh / 40850 FlyBaseID:FBgn0261238 Length:1717 Species:Drosophila melanogaster
Sequence 2:NP_001076274.1 Gene:kdm4b / 556504 ZFINID:ZDB-GENE-060503-664 Length:1134 Species:Danio rerio


Alignment Length:260 Identity:79/260 - (30%)
Similarity:113/260 - (43%) Gaps:52/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LVYCDGQNCTVAVHQACYGI--VTVPTGPWYCRKCESQERTSRVRCELCPSRDGALKKTDNSGWA 137
            |:.|.|  |.:.||.:|||:  .|...| |.|.:|.:...|:  .|.||..|.||||||.:..|.
Zfish   743 LLSCSG--CNLQVHASCYGVNPQTKQEG-WMCSRC
TTVAWTA--ACCLCSLRGGALKKTTDERWV 802

  Fly   138 HVVCALYIPEVRFGNVTTMEPIILSLIPQERYSKTCYICQEIGKPNRANVGACMQCNKSNCKQQF 202
            ||:||:.:.||||.|....||:.::.:|:.|.|..|..|.   |..:...|||:||::.||...|
Zfish   803 HVICAIAVAEVRFVNAIEREPVDVTAVPETRKSLKCVYCH---KTTKQIFGACIQCSQDNCSTSF 864

  Fly   203 HVTCAQSLGLLCEEAG-NYLDNVKYCGYCQHH---YSKLKKGGNVKTI----------------- 246
            |||||...|::.:.|. .|:.:|.    |..|   ..|.|.|....::                 
Zfish   865 HVTCALLAGVVMKPADWPYVVSVT----CHKHKLTNQKAKSGSRDLSLGQEVIGRNSNGWFYRCV 925

  Fly   247 ------PPYKPIQHDTSSDSCSS--PEKEI--DSTMNSATTSATIIKITSSSGSAGGSSNVLNAS 301
                  ..|..:..|..| .|.:  ||..:  |...|.......::.:.:..|      .|||||
Zfish   926 ITGTGTQTYYEVNFDDGS-YCDNIFPENLLSHDCLRNGPPELGELVVVKTVDG------RVLNAS 983

  Fly   302  301
            Zfish   984  983

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlhNP_001262332.1 PHD_AF10_AF17 60..107 CDD:277049 13/33 (39%)
ePHD_AF10_like 118..233 CDD:277142 46/115 (40%)
kdm4bNP_001076274.1 JmjN 95..136 CDD:128818
JmjC 256..372 CDD:202224
YscO <408..512 CDD:284686
PHD_JMJD2B 676..774 CDD:277051 13/33 (39%)
PHD_SF 783..892 CDD:304600 46/115 (40%)
TUDOR 905..953 CDD:197660 6/48 (13%)
tatB <978..1099 CDD:166942 5/6 (83%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.