DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alh and BRD1

DIOPT Version :9

Sequence 1:NP_001262332.1 Gene:Alh / 40850 FlyBaseID:FBgn0261238 Length:1717 Species:Drosophila melanogaster
Sequence 2:NP_001291737.1 Gene:BRD1 / 23774 HGNCID:1102 Length:1189 Species:Homo sapiens


Alignment Length:213 Identity:85/213 - (39%)
Similarity:112/213 - (52%) Gaps:36/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CCVCSDERGWPENPLVYCDGQNCTVAVHQACYGIVTVPTGPWYCRKCESQERTSRVRCELCPSRD 125
            ||:|.|......|.:::||  .|.:||||.|||:..:|.|.|.||.| .|.|.....|.|||::.
Human   217 CCICMDGECQNSNVILFCD--MCNLAVHQECYGVPYIPEGQWLCRHC-LQSRAR
PADCVLCPNKG 278

  Fly   126 GALKKTDNSGWAHVVCALYIPEVRFGNVTTMEPII-LSLIPQERYSKTCYICQEIGKPNRANVGA 189
            ||.||||:..|.||||||:||||.|.|...:|||. :..||..|:..|||:|::.|      |||
Human   279 GAFKKTDDDRWGHVVCALWIPEVGFANTVFIEPIDGVRNIPPARWKLTCYLCKQKG------VGA 337

  Fly   190 CMQCNKSNCKQQFHVTCAQSLGLLCE-------EAGNYLDNVKYCGYCQHH------------YS 235
            |:||:|:||...|||||||..||..:       ..|....:|:...||..|            |.
Human   338 CIQCHKANCYTAFHVTCAQKAGLYMKMEPVKELTGGGTTFSVRKTAYCDVHTPPGCTRRPLNIYG 402

  Fly   236 KL-------KKGGNVKTI 246
            .:       :|..:|||:
Human   403 DVEMKNGVCRKESSVKTV 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlhNP_001262332.1 PHD_AF10_AF17 60..107 CDD:277049 20/45 (44%)
ePHD_AF10_like 118..233 CDD:277142 56/122 (46%)
BRD1NP_001291737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Interaction with KAT7/HBO1 and histones. /evidence=ECO:0000269|PubMed:28334966 31..80
EPL1 47..196 CDD:287484
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..116
PHD_BRPF2 214..267 CDD:277147 23/52 (44%)
ePHD_BRPF2 271..388 CDD:277172 56/122 (46%)
Bromo_brd1_like 566..663 CDD:99944
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 755..776
BR140_related 1058..1173 CDD:99900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D566217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1726
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.