Sequence 1: | NP_001262332.1 | Gene: | Alh / 40850 | FlyBaseID: | FBgn0261238 | Length: | 1717 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001291737.1 | Gene: | BRD1 / 23774 | HGNCID: | 1102 | Length: | 1189 | Species: | Homo sapiens |
Alignment Length: | 213 | Identity: | 85/213 - (39%) |
---|---|---|---|
Similarity: | 112/213 - (52%) | Gaps: | 36/213 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 CCVCSDERGWPENPLVYCDGQNCTVAVHQACYGIVTVPTGPWYCRKCESQERTSRVRCELCPSRD 125
Fly 126 GALKKTDNSGWAHVVCALYIPEVRFGNVTTMEPII-LSLIPQERYSKTCYICQEIGKPNRANVGA 189
Fly 190 CMQCNKSNCKQQFHVTCAQSLGLLCE-------EAGNYLDNVKYCGYCQHH------------YS 235
Fly 236 KL-------KKGGNVKTI 246 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Alh | NP_001262332.1 | PHD_AF10_AF17 | 60..107 | CDD:277049 | 20/45 (44%) |
ePHD_AF10_like | 118..233 | CDD:277142 | 56/122 (46%) | ||
BRD1 | NP_001291737.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..26 | ||
Interaction with KAT7/HBO1 and histones. /evidence=ECO:0000269|PubMed:28334966 | 31..80 | ||||
EPL1 | 47..196 | CDD:287484 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 92..116 | ||||
PHD_BRPF2 | 214..267 | CDD:277147 | 23/52 (44%) | ||
ePHD_BRPF2 | 271..388 | CDD:277172 | 56/122 (46%) | ||
Bromo_brd1_like | 566..663 | CDD:99944 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 755..776 | ||||
BR140_related | 1058..1173 | CDD:99900 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D566217at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1726 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.950 |