DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alh and Kdm4b

DIOPT Version :9

Sequence 1:NP_001262332.1 Gene:Alh / 40850 FlyBaseID:FBgn0261238 Length:1717 Species:Drosophila melanogaster
Sequence 2:XP_030105461.1 Gene:Kdm4b / 193796 MGIID:2442355 Length:1124 Species:Mus musculus


Alignment Length:228 Identity:69/228 - (30%)
Similarity:110/228 - (48%) Gaps:36/228 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 NPLVYCDGQNCTVAVHQACYGI-VTVPTGPWYCRKCESQERTSRVRCELCPSRDGALKKTDNSGW 136
            :||:.|  .:|.:.||.:|||: ..:....|.|.:|.:...|:  .|.||..|.|||::|....|
Mouse   781 SPLISC--AHCCLQVHASCYGVRPELAKEGWTCSRC
AAHAWTA--ECCLCNLRGGALQRTTEHRW 841

  Fly   137 AHVVCALYIPEVRFGNVTTMEPIILSLIPQERYSKTCYICQEIGKPNRANVGACMQCNKSNCKQQ 201
            .||:||:.:|||||.||....|:.:|.||::|:...|..|::  :..|.: |||:||:..:|...
Mouse   842 IHVICAIAVPEVRFLNVIERNPVDVSAIPEQRWKLKCIYCRK--RMKRVS-GACIQCSYEHCSTS 903

  Fly   202 FHVTCAQSLGLLCE-EAGNYLDNVKYCGYCQHHYSKLKKGGNVKTIPPYKPIQHDTSSDSCSSPE 265
            ||||||.:.|:|.| :...|:.::.    |..|.:....|..::|:               |..:
Mouse   904 FHVTCAHAAGVLMEPDDWPYVVSIT----CLKHRASGAGGQLLRTV---------------SLGQ 949

  Fly   266 KEIDSTMNS--------ATTSATIIKITSSSGS 290
            ..|....|.        .||:.|..::....||
Mouse   950 IVITKNRNGLYYRCRVIGTTAQTFYEVNFDDGS 982

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlhNP_001262332.1 PHD_AF10_AF17 60..107 CDD:277049 11/34 (32%)
ePHD_AF10_like 118..233 CDD:277142 45/115 (39%)
Kdm4bXP_030105461.1 JmjN 15..56 CDD:128818
JmjC 176..292 CDD:334913
PHD_SF 680..814 CDD:389947 11/34 (32%)
PHD_SF 823..932 CDD:389947 45/115 (39%)
Tudor_2 948..982 CDD:375553 5/33 (15%)
Tudor_2 1006..1040 CDD:375553
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.