DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alh and brpf3b

DIOPT Version :9

Sequence 1:NP_001262332.1 Gene:Alh / 40850 FlyBaseID:FBgn0261238 Length:1717 Species:Drosophila melanogaster
Sequence 2:XP_005166793.1 Gene:brpf3b / 100003354 ZFINID:ZDB-GENE-081104-468 Length:1222 Species:Danio rerio


Alignment Length:255 Identity:89/255 - (34%)
Similarity:125/255 - (49%) Gaps:46/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CCVCSDERGWPENPLVYCDGQNCTVAVHQACYGIVTVPTGPWYCRKCESQERTSRVRCELCPSRD 125
            ||||.|:.....|.:::||  .|.:||||.|||:..:|.|.|.||.| .|..:..|.|.|||:|.
Zfish   252 CCVCLDDECLNSNVILFCD--ICNLAVHQECYGVPYIPEGQWLCRCC-LQSPSR
PVDCVLCPNRG 313

  Fly   126 GALKKTDNSGWAHVVCALYIPEVRFGNVTTMEPII-LSLIPQERYSKTCYICQEIGKPNRANVGA 189
            ||.|:|.:..|||||||::||||.|.|...:|||. :..||..|:..|||:|::.|      .||
Zfish   314 GAFKQTSDGRWAHVVCAIWIPEVCFANTVFLEPIEGVDNIPPARWKLTCYLCKQKG------CGA 372

  Fly   190 CMQCNKSNCKQQFHVTCAQSLGLLCEEAGNYLD------------NVKYCGYCQHHYSKL----- 237
            .:||:|:||...|||||||..||..:     :|            :||...:|:.|...:     
Zfish   373 SIQCHKANCYTAFHVTCAQRAGLFMK-----IDPVRETTVNGTTFSVKKTAFCEAHSPAVNGSDD 432

  Fly   238 -KKGGNV------------KTIPPYKPIQHDTSSDSCSSPEKEIDSTMNSATTSATIIKI 284
             :.||.|            ...|..|..:.....|| ..|:|:......|..|:..::.:
Zfish   433 EETGGRVLGCRANRGRSAYMQTPELKKQKGSNKVDS-KQPQKKGKKEEVSKKTTTLLVTV 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlhNP_001262332.1 PHD_AF10_AF17 60..107 CDD:277049 21/45 (47%)
ePHD_AF10_like 118..233 CDD:277142 53/127 (42%)
brpf3bXP_005166793.1 EPL1 63..231 CDD:287484
PHD_BRPF 249..302 CDD:277047 23/52 (44%)
PHD_SF 306..423 CDD:304600 53/127 (42%)
Kinesin-relat_1 535..>594 CDD:289481
Bromo_brd1_like 608..705 CDD:99944
BR140_related 1091..1206 CDD:99900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D566217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1726
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.