DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and MICAL2

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001380866.1 Gene:MICAL2 / 9645 HGNCID:24693 Length:1957 Species:Homo sapiens


Alignment Length:190 Identity:42/190 - (22%)
Similarity:62/190 - (32%) Gaps:60/190 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PSFQPIEAPKCPRCGKSVYAA-----EERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCK 61
            ||..|...|.......:|.:|     |::...|:.||.:                       :.:
Human   903 PSRLPSPDPAASSSPSTVDSASPARKEKKSPSGFHFHPS-----------------------HLR 944

  Fly    62 TCHGR-KFGPKGYGFGTGAGTLSMDNGSQFLRENGDVPSVRNGARLEPRAIARAPEGEG------ 119
            |.|.: ..|....|.|..|..|              |....|..|  |:|.|.:|:.|.      
Human   945 TVHPQLTVGKVSSGIGAAAEVL--------------VNLYMNDHR--PKAQATSPDLESMRKSFP 993

  Fly   120 --------CPRCGGYVYAAEQMLARGRSWHKECFKCGTCKKGLD-SILCCEAPDKNIYCK 170
                    |..|...||..|::.|.|..:|:|||:|..|...|. :....:..:...|||
Human   994 LNLGGSDTCYFCKKRVYVMERLSAEGHFFHRECFRCSICATTLRLAAYTFDCDEGKFYCK 1053

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 7/57 (12%)
LIM_CRP_like 120..173 CDD:188712 17/52 (33%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
MICAL2NP_001380866.1 Monooxygenase domain. /evidence=ECO:0000250|UniProtKB:Q8VDP3 2..494
UbiH 87..>226 CDD:357568
CH 522..617 CDD:214479
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 660..714
Nuclear localization signal. /evidence=ECO:0000269|PubMed:24440334 660..681
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 886..942 10/61 (16%)
LIM_Mical 1002..1056 CDD:188823 17/52 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1072..1094
PHA03247 <1087..1624 CDD:223021
ProQ 1628..1718 CDD:198013
DUF5401 <1773..>1944 CDD:375164
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.