DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and PLIM2b

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_171683.1 Gene:PLIM2b / 839267 AraportID:AT1G01780 Length:205 Species:Arabidopsis thaliana


Alignment Length:246 Identity:59/246 - (23%)
Similarity:85/246 - (34%) Gaps:70/246 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKTCHGRKFGPKGYGF 75
            ||..|.|:||..:.....|..:||:||:|..|..:|..:|.:..:..|||||             
plant     9 KCNVCDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLQMSNYSSMDGVLYCKT------------- 60

  Fly    76 GTGAGTLSMDNGSQFLRENGDVPSVRNGARLEPRAIARAPE---------GEGCPRCGGYVYAAE 131
                      :..|..:|:|:........:.|...:.|.|.         .:.|..|...||..|
plant    61 ----------HFEQLFKESGNFSKNFQPGKTEKPELTRTPSKISSIFCGTQDKCAACEKTVYPLE 115

  Fly   132 QMLARGRSWHKECFKC--GTCK------KGLDSILCCEAPDKNIYCKGCYAKKFGPKGYGYGQGG 188
            ::...|..:||.||:|  |.|.      ..|||:|         ||:..:.:.|..||.      
plant   116 KIQMEGECFHKTCFRCAHGGCTLTHSSYASLDSVL---------YCRHHFNQLFMEKGN------ 165

  Fly   189 GALQSDCYAHDDGAPQIRAAIDVDKIQARPGEGCPRCGGVVYAAEQKLSKG 239
                   |||...|...|.....:.:...|.|.        .|.|.|...|
plant   166 -------YAHVLQAANHRRTASGNTLPPEPTED--------VAVEAKEENG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 20/52 (38%)
LIM_CRP_like 120..173 CDD:188712 19/60 (32%)
LIM_CRP_like 222..275 CDD:188712 4/18 (22%)
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
PLIM2bNP_171683.1 LIM1_SF3 6..68 CDD:188824 21/81 (26%)
LIM 104..164 CDD:413332 20/68 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm966
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.