DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and WLIM2b

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001190099.1 Gene:WLIM2b / 824743 AraportID:AT3G55770 Length:233 Species:Arabidopsis thaliana


Alignment Length:217 Identity:59/217 - (27%)
Similarity:79/217 - (36%) Gaps:69/217 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKTCHGRKFGPKGYGF 75
            ||..|.|:|||.|...|.|..:||:||||..|...|..::.:..|..||||....:.|...|   
plant     9 KCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKPHFEQLFKESG--- 70

  Fly    76 GTGAGTLSMDNGSQFLRENGD--VPSVRNGARLEPRAIARAPEG--EGCPRCGGYVYAAEQM--- 133
                   |.:...|...::.|  .|.:..    .|..:|....|  |.|..|...||..|::   
plant    71 -------SFNKNFQSPAKSADKSTPELTR----TPSRVAGRFSGTQEKCATCSKTVYPIEKIHNP 124

  Fly   134 -----LAR--------------------------GRSWHKECFKC--GTCK------KGLDSILC 159
                 |||                          .:::||.||||  |.|.      ..|:.|| 
plant   125 LSYRELARKPNVLHRCIDPGDIGSCYFNLHVTVESQTYHKSCFKCSHGGCPISPSNYAALEGIL- 188

  Fly   160 CEAPDKNIYCKGCYAKKFGPKG 181
                    |||..:|:.|..||
plant   189 --------YCKHHFAQLFKEKG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 23/52 (44%)
LIM_CRP_like 120..173 CDD:188712 22/94 (23%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
WLIM2bNP_001190099.1 LIM1_SF3 6..68 CDD:188824 24/58 (41%)
LIM 108..202 CDD:295319 24/102 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm966
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.